PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D07G1479
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family SBP
Protein Properties Length: 290aa    MW: 32631.9 Da    PI: 8.7871
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D07G1479genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP131.72.5e-41173250178
                  --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
          SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                  +Cq+egC+adl++ak+yhrrhkvCe+hska++v+++gl+qrfCqqCsrfh lsefD++krsCr+rLa+hn+rrrk+q+
  Gh_D07G1479 173 RCQAEGCNADLTQAKHYHRRHKVCEFHSKASTVIAAGLTQRFCQQCSRFHLLSEFDNGKRSCRKRLADHNRRRRKSQQ 250
                  6**************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.104.3E-35168235IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.402171248IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.44E-38172251IPR004333Transcription factor, SBP-box
PfamPF031103.9E-31174247IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 290 aa     Download sequence    Send to blast
MLEYEWGNPS SIMLSGEETA QEPDPNRQLF HHYATTTTTT HHQPYNETLL SHHNPTVFSH  60
QNLFHNPNQA QPPQHPATLH SLYDPHSYSA TSAYSTTHAS LLSLDPVSAV GGSGGGYFLV  120
PKTEEVSRPV DFTARIGLNL GGRTYFSSAE DDFVNRLYRR SRPGDLSSTN SPRCQAEGCN  180
ADLTQAKHYH RRHKVCEFHS KASTVIAAGL TQRFCQQCSR FHLLSEFDNG KRSCRKRLAD  240
HNRRRRKSQQ QQPNTTQENQ KHLPLESGGN PSSDNPQGHR RILGSSHLLQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-311742471184squamosa promoter binding protein-like 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.29210.0boll| ovule
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012483130.10.0PREDICTED: squamosa promoter-binding-like protein 8 isoform X1
RefseqXP_012483136.10.0PREDICTED: squamosa promoter-binding-like protein 8 isoform X1
SwissprotQ8GXL34e-83SPL8_ARATH; Squamosa promoter-binding-like protein 8
TrEMBLA0A0B0N0S50.0A0A0B0N0S5_G
STRINGVIT_15s0021g02300.t011e-103(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM70102743
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G02065.13e-79squamosa promoter binding protein-like 8